Recombinant Human Phosphoribosylformylglycinamidine synthase(PFAS),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP017811HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Signal Transduction
Target / Protein
PFAS
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
O15067
AA Sequence
RVAILREEGSNGDREMADAFHLAGFEVWDVTMQDL CSGAIGLDTFRGVAFVGGFSYADVLGSAKGWAAAV TFHPRAGAELRRFRKRPDTFSLGVCNGCQLLALLG WVGGDPNEDAAEMGPDSQPARPGLLLRHNLSGRYE SRWASVRVGPGPALMLRGMEGAVLPVWSAHGEGYV AFSSPELQAQIEARGLAPLHWADDDGNPTEQYPLN PNGSPGGVAGICSCDGRHLAVMPHPERAV
Tag info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
1064-1302aa
Protein length
Partial
MW
45.4 kDa
Relevance
Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.
Reference
"Genomic cloning and sequence analyses of the bovine alpha-, beta A- and beta B-inhibin/activin genes. Identification of transcription factor AP-2-binding sites in the 5'-flanking regions by DNase I footprinting."
Thompson D.A., Cronin C.N., Martin F.
Eur. J. Biochem. 226:751-764(1994)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close