Recombinant Human Paraneoplastic antigen Ma2(PNMA2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
Item no. CSB-EP018267HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
Q9UL42
Gene Names
PNMA2 KIAA0883 MA2
Organism
Homo sapiens (Human)
AA Sequence
ALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQ EVLQETLKSLGRYRLLGKIFRKQENANAVLLELLE DTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERL NLFLEKEGQTVSGMFRALGQEGVSPATVPCISPEL LAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAP EEESFEVWLEQATEIVKEWPVTEAEKKRWLAESLR GPALDLMHIVQADNPSISVEECLEAFKQVFGSLES RRTAQVRYLKTYQEEGEKVSAYVLRLETLLRRAVE KRAIPRRIADQVRLEQVMAGATLNQMLWCRLRELK DQGPPPSFLELMKVIREEEEEEASFENESIEEPEE RDGYGRWNHE
Expression Region
2-261aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
45.1 kDa
Alternative Name(s)
40KDA neuronal proteinOnconeuronal antigen Ma2; Paraneoplastic neuronal antigen MM2
Reference
Complete sequencing and characterization of 21, 243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close