Recombinant Human Paraneoplastic antigen Ma2(PNMA2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP018267HUa2-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Tags & Cell Markers
Target / Protein
PNMA2
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
Q9UL42
AA Sequence
ALALLEDWCRIMSVDEQKSLMVTGIPADFEEAEIQ EVLQETLKSLGRYRLLGKIFRKQENANAVLLELLE DTDVSAIPSEVQGKGGVWKVIFKTPNQDTEFLERL NLFLEKEGQTVSGMFRALGQEGVSPATVPCISPEL LAHLLGQAMAHAPQPLLPMRYRKLRVFSGSAVPAP EEESFEVWLEQATEIVKEWPVTEAEKKRWLAESLR GPALDLMHIVQADNPSISVEECLEAFKQVFGSLES RRTAQVRYLKTYQEEGEKVSAYVLRLETLLRRAVE KRAIPRRIADQVRLEQVMAGATLNQMLWCRLRELK DQGPPPSFLELMKVIREEEEEEASFENESIEEPEE RDGYGRWNHE
Tag info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-361aa
Protein length
Partial
MW
57.1 kDa
Alternative Name(s)
40KDA neuronal protein
Onconeuronal antigen Ma2
Paraneoplastic neuronal antigen MM2
Relevance
Antibodies against PNMA2 are present in sera from patients suffering of paraneoplastic neurological disorders.
Reference
"A serologic marker of paraneoplastic limbic and brain-stem encephalitis in patients with testicular cancer."
Voltz R., Gultekin S.H., Rosenfeld M.R., Gerstner E., Eichen J., Posner J.B., Dalmau J.
N. Engl. J. Med. 340:1788-1795(1999)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close