Recombinant Human DNA-directed RNA polymerase III subunit RPC10(POLR3K)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP018352HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
Q9Y2Y1
Gene Names
POLR3K
Organism
Homo sapiens (Human)
AA Sequence
MLLFCPGCGNGLIVEEGQRCHRFSCNTCPYVHNIT RKVTNRKYPKLKEVDDVLGGAAAWENVDSTAESCP KCEHPRAYFMQLQTRSADEPMTTFYKCCNAQCGHR WRD
Expression Region
1-108aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
28.3 kDa
Alternative Name(s)
DNA-directed RNA polymerase III subunit KRNA polymerase III 12.5KDA subunit ; RPC12.5RNA polymerase III subunit C11 ; HsC11p ; RPC11 ; hRPC11
Relevance
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as tplate for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway .
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close