Comparison

Recombinant Human Ribonuclease P protein subunit p29(POP4)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP018373HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O95707
Gene Names
POP4
Organism
Homo sapiens (Human)
AA Sequence
MKSVIYHALSQKEANDSDVQPSGAQRAEAFVRAFL KRSTPRMSPQAREDQLQRKAVVLEYFTRHKRKEKK KKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHEL WKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAII SVTKSKCPSYVGITGILLQETKHIFKIITKEDRLK VIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAK KFKAKGTIDL
Expression Region
1-220aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
41.4 kDa
Relevance
Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assbly of RNase P.
Reference
Rpp14 and Rpp29, two protein subunits of human ribonuclease P.Jarrous N., Eder P.S., Wesolowski D., Altman S.RNA 5:153-157(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. May function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P.
Subcellular Location
Nucleus, nucleolus
Protein Families
Eukaryotic/archaeal RNase P protein component 1 family
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close