Comparison

Recombinant Human Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform(PPP3CC),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP018574HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
CAM-PRP catalytic subunitCalcineurin, testis-specific catalytic subunitCalmodulin-dependent calcineurin A subunit gamma isoform
AA Sequence
SGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGK PKVDVLKNHLVKEGRLEEEVALKIINDGAAILRQE KTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSN TRYLFLGDYVDRGYFSIECVLYLWSLKINHPKTLF LLRGNHECRHLTDYFTFKQECRIKYSEQVYDACME TFDCLPLAALLNQQFLCVHGGMSPEITSLDDIRKL DRFTEPPAFGPVCDLLWSDPSEDYGNEKTLEHYTH NTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQD AGYRMYRKSQATGFPSLITIFSAPNYLDVYNNKAA VLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLP FVGEKVTEMLVNVLNICSDDELISDDEAEGSTTVR KEIIRNKIRAIGKMARVFSILRQESESVLTLKGLT PTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFS LQHKIRSFEEARGLDRINERMPPRKDSIHAGGPMK SVTSAHSHAAHRSDQGKKAHS
Research Topic
Signal Transduction
Uniprot ID
P48454
Gene Names
PPP3CC
Tag Info
N-terminal 6xHis-tagged
Expression Region
2-512aa
MW of Fusion Proten
62
Sequence Info
Partial
Relevance
Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.
Reference
DNA sequence and analysis of human chromosome 8.Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.Nature 439:331-335(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close