Recombinant Human Peroxiredoxin-1(PRDX1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP018653HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Cardiovascular
Target / Protein
PRDX1
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
Q06830
AA Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYK GKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLN CQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLV SDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILR QITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPA GWKPGSDTIKPDVQKSKEYFSKQK
Tag info
N-terminal 6xHis-tagged
Expression Region
1-199aa
Protein length
Full Length
MW
27.6 kDa
Alternative Name(s)
Natural killer cell-enhancing factor A
Proliferation-associated gene protein
Thioredoxin peroxidase 2
Thioredoxin-dependent peroxide reductase 2
PAGA, PAGB, TDPX2
Relevance
Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2. Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation
Reference
"A method for detection of overoxidation of cysteines: peroxiredoxins are oxidized in vivo at the active-site cysteine during oxidative stress."
Wagner E., Luche S., Penna L., Chevallet M., van Dorsselaer A., Leize-Wagner E., Rabilloud T.
Biochem. J. 366:777-785(2002)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close