Comparison

Recombinant Human Perforin-1(PRF1)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 50ug
Host E.coli
Item no. CSB-EP018668HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research areas
Immunology
Target / Protein
PRF1
Biologically active
Not Test
Expression system
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P14222
AA Sequence
PCHTAARSECKRSHKFVPGAWLAGEGVDVTSLRRS GSFPVDTQRFLRPDGTCTLCENALQEGTLQRLPLA LTNWRAQGSGCQRHVTRAKVSSTEAVARDAARSIR NDWKVGLDVTPKPTSNVHVSVAGSHSQAANFAAQK THQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKRA LGDLPHHFNASTQPAYLRLISNYGTHFIRAVELGG RISALTALRTCELALEGLTDNEVEDCLTVEAQVNI GIHGSISAEAKACEEKKKKHKMTASFHQTYRERHS EVVGGHHTSINDLLFGIQAGPEQYSAWVNSLPGSP GLVDYTLEPLHVLLDSQDPRREALRRALSQYLTDR ARWRDCSRPCPPGRQKSPRDPCQCVCHGSAVTTQD CCPRQRGLAQLEVTFIQAWGLWGDWFTATDAYVKL FFGGQELRTSTVWDNNNPIWSVRLDFGDVLLATGG PLRLQVWDQDSGRDDDLLGTCDQAPKSGSHEVRCN LNHGHLKFRYHARCLPHLGGGTCLDYVPQMLLGEP PGNRSGAVW
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
22-555aa
Protein length
Full Length of Mature Protein
MW
75.2 kDa
Alternative Name(s)
Cytolysin; Lymphocyte pore-forming protein ; PFP
Relevance
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune syst, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the mbrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
References
The DNA sequence and comparative analysis of human chromosome 10.Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.Nature 429:375-381(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Plays a key role in secretory granule-dependent cell death, and in defense against virus-infected or neoplastic cells. Plays an important role in killing other cells that are recognized as non-self by the immune system, e.g. in transplant rejection or some forms of autoimmune disease. Can insert into the membrane of target cells in its calcium-bound form, oligomerize and form large pores. Promotes cytolysis and apoptosis of target cells by facilitating the uptake of cytotoxic granzymes.
Involvement in disease
Familial hemophagocytic lymphohistiocytosis 2 (FHL2)
Subcellular Location
Cytoplasmic granule lumen, Secreted, Cell membrane, Multi-pass membrane protein, Endosome lumen
Protein Families
Complement C6/C7/C8/C9 family
Paythway
Apoptosis
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close