Comparison

Recombinant Human Serine protease 23(PRSS23)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018817HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Putative secreted protein Zsig13
AA Sequence
QVSPYSAPWKPTWPAYRLPVVLPQSTLNLAKPDFG AEAKLEVSSSCGPQCHKGTPLPTYEEAKQYLSYET LYANGSRTETQVGIYILSSSGDGAQHRDSGSSGKS RRKRQIYGYDSRFSIFGKDFLLNYPFSTSVKLSTG CTGTLVAEKHVLTAAHCIHDGKTYVKGTQKLRVGF LKPKFKDGGRGANDSTSAMPEQMKFQWIRVKRTHV PKGWIKGNANDIGMDYDYALLELKKPHKRKFMKIG VSPPAKQLPGGRIHFSGYDNDRPGNLVYRFCDVKD ETYDLLYQQCDAQPGASGSGVYVRMWKRQQQKWER KIIGIFSGHQWVDMNGSPQDFNVAVRITPLKYAQI CYWIKGNYLDCREG
Research Topic
Signal Transduction
Uniprot ID
O95084
Gene Names
PRSS23
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
20-383aa
MW of Fusion Proten
57
Sequence Info
Full Length
Reference
A novel serine protease from human umbilical vein endothelial cells.Li X., Tedder T.F. Sheppard P., Blumberg H., Jelinek L., Foster D., O'Hara P.Towards a catalog of human genes and proteins sequencing and analysis of 500 novel complete protein coding human cDNAs.Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.Genome Res. 11:422-435(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close