Comparison

Recombinant Human Receptor-type tyrosine-protein phosphatase zeta(PTPRZ1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP019068HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Protein-tyrosine phosphatase receptor type Z polypeptide 1; Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2
AA Sequence
IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDL TQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEIN LTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGS EHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGK LRALSILFEVGTEENLDFKAIIDGVESVSRFGKQA ALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVD WIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDY LQNNFREQQYKFSRQVFSSY
Research Topic
Neuroscience
Uniprot ID
P23471
Gene Names
PTPRZ1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
36-300aa
MW of Fusion Proten
46, 1
Sequence Info
Full Length
Relevance
Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades .
Reference
DNA sequence and biology.Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.Science 300:767-772(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close