Recombinant Human Glutaminyl-peptide cyclotransferase(QPCT)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP019135HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Neuroscience
Target / Protein
QPCT
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
Q16769
AA Sequence
VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSIS EMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRL QADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKR HLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMML ELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEA FLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQL HGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQA IEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHI PFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDEST IDNLNKILQVFVLEYLHL
Tag info
N-terminal 6xHis-SUMO-tagged
Expression Region
29-361aa
Protein length
Full Length of Mature Protein
MW
53.9 kDa
Alternative Name(s)
Glutaminyl cyclase ; QC ; sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase ; EC
Relevance
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.
Reference
Structures of human Golgi-resident glutaminyl cyclase and its complexes with inhibitors reveal a large loop movement upon inhibitor binding.Huang K.F., Liaw S.S., Huang W.L., Chia C.Y., Lo Y.C., Chen Y.L., Wang A.H.J. Biol. Chem. 286:12439-12449(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close