Recombinant Human ATP-dependent DNA helicase Q1(RECQL)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP019537HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P46063
Gene Names
RECQL
Organism
Homo sapiens (Human)
AA Sequence
MASVSALTEELDSITSELHAVEIQIQELTERQQEL IQKKKVLTKKIKQCLEDSDAGASNEYDSSPAAWNK EDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMA GKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPL ISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHA EMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEA RRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQF PNASLIGLTATATNHVLTDAQKILCIEKCFTFTAS FNRPNLYYEVRQKPSNTEDFIEDIVKLINGRYKGQ SGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEP EDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRF VIHHSMSKSMENYYQESGRAGRDDMKADCILYYGF GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRR VLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNIT EYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAA KLRVAGVVAPTLPREDLEKIIAHFLIQQYLKEDYS FTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQ NSFRAESSQTCHSEQGDKKMEEKNSGNFQKKAANM LQQSGSKNTGAKKRKIDDA
Expression Region
1-649aa
Sequence Info
Full Length
Tag Info
NO-tagged
MW
73.5 kDa
Alternative Name(s)
DNA helicase, RecQ-like type 1
Short name:
RecQ1
DNA-dependent ATPase Q1
RecQ protein-like 1
RECQ1, RECQL1
Relevance
DNA helicase that may play a role in the repair of DNA that is damaged by ultraviolet light or other mutagens. Exhibits a magnesium-dependent ATP-dependent DNA-helicase activity that unwinds single- and double-stranded DNA in a 3'-5' direction.
Reference
"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €331.43
Price: €331.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close