Recombinant Human Ribonuclease H1(RNASEH1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 100ug
Host E.coli
ArtNr CSB-EP019801HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O60930
Gene Names
RNASEH1
Organism
Homo sapiens (Human)
AA Sequence
MSWLLFLAHRVALAALPCRRGSRGFGMFYAVRRGR KTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAF VRKSASPEVSEGHENQHGQESEAKASKRLREPLDG DGHESAEPYAKHMKPSVEPAPPVSRDTFSYMGDFV VVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIR LPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTD SMFTINGITNWVQGWKKNGWKTSAGKEVINKEDFV ALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREG AKQSED
Expression Region
1-286aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-tagged
MW
37.6 kDa
Alternative Name(s)
Ribonuclease H type II
RNH1
Relevance
Endonuclease that specifically degrades the RNA of RNA-DNA hybrids (PubMed:10497183). Plays a role in RNA polymerase II (RNAp II) transcription termination by degrading R-loop RNA-DNA hybrid formation at G-rich pause sites located downstream of the poly(A) site and behind the elongating RNAp II
Reference
"Human senataxin resolves RNA/DNA hybrids formed at transcriptional pause sites to promote Xrn2-dependent termination."
Skourti-Stathaki K., Proudfoot N.J., Gromak N.
Mol. Cell 42:794-805(2011)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 100ug
Available: In stock
Listprice: €450.71
Price: €450.71
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close