Recombinant Human 60S acidic ribosomal protein P2(RPLP2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP020342HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cancer
Uniprot ID
P05387
Gene Names
RPLP2
Organism
Homo sapiens (Human)
AA Sequence
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEAD DDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA VAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEES DDDMGFGLFD
Expression Region
1-115aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-tagged
MW
15.7 kDa
Alternative Name(s)
Large ribosomal subunit protein P2
Renal carcinoma antigen NY-REN-44
D11S2243E, RPP2
Relevance
Plays an important role in the elongation step of protein synthesis.
Reference
"Human acidic ribosomal phosphoproteins P0, P1, and P2: analysis of cDNA clones, in vitro synthesis, and assembly."
Rich B.E., Steitz J.A.
Mol. Cell. Biol. 7:4065-4074(1987)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close