Recombinant Human Ryanodine receptor 3(RYR3),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
Item no. CSB-EP020621HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
Q15413
Gene Names
RYR3
Organism
Homo sapiens (Human)
AA Sequence
DGKGIISKKEFQKAMEGQKQYTQSEIDFLLSCAEA DENDMFNYVDFVDRFHEPAKDIGFNVAVLLTNLSE HMPNDSRLKCLLDPAESVLNYFEPYLGRIEIMGGA KKIERVYFEISESSRTQWEKPQVKESKRQFIFDVV NEGGEQEKMELFVNFCEDTIFEMQLASQISESDSA DRPEEEEEDEDSSYVLEIAGEEEEDGSLEPASAFA MACASVKRNVTDFLKRATLKNLRKQYRNVKKMTAK ELV
Expression Region
3934-4181aa
Sequence Info
Partial
Tag Info
N-terminal 6xHis-tagged
MW
32.5 kDa
Alternative Name(s)
Brain ryanodine receptor-calcium release channelBrain-type ryanodine receptorType 3 ryanodine receptor
Relevance
Calcium channel that mediates the release of Ca2+ from the sarcoplasmic reticulum into the cytoplasm in muscle and thereby plays a role in triggering muscle contraction. May regulate Ca2+ release by other calcium channels. Calcium channel that mediates Ca2+-induced Ca2+ release from the endoplasmic reticulum in non-muscle cells. Contributes to cellular calcium ion homeostasis . Plays a role in cellular calcium signaling.1 Publication
Reference
Characterization of the binding sites for the interactions between FKBP12 and intracellular calcium release channels.Wen H., Kang S., Song Y., Song Y., Yang H.J., Kim M.H., Park S.Arch. Biochem. Biophys. 517:37-42(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close