Recombinant Human Band 3 anion transport protein (SLC4A1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 50ug
Host E.coli
ArtNr CSB-EP021663HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Cardiovascular
Target / Protein
SLC4A1
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P02730
AA Sequence
MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPA AHDTEATATDYHTTSHPGTHKVYVELQELVMDEKN QELRWMEAARWVQLEENLGENGAWGRPHLSHLTFW SLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFI FEDQIRPQDREELLRALLLKHSHAGELEALGGVKP AVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEG HSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFV RLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQ LGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFL DCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS PAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRD IRRRYPYYLSDITDAFSP
Tag info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
1-403aa
Protein length
Partial
MW
65.3 kDa
Alternative Name(s)
Anion exchange protein 1
Relevance
Functions both as a transporter that mediates electroneutral anion exchange across the cell membrane and as a structural protein. Major integral membrane glycoprotein of the erythrocyte membrane; required for normal flexibility and stability of the erythrocyte membrane and for normal erythrocyte shape via the interactions of its cytoplasmic domain with cytoskeletal proteins, glycolytic enzymes, and hemoglobin. Functions as a transporter that mediates the 1:1 exchange of inorganic anions across the erythrocyte membrane. Mediates chloride-bicarbonate exchange in the kidney, and is required for normal acidification of the urine.
Reference
"Recessive distal renal tubular acidosis in Sarawak caused by AE1 mutations."
Choo K.E., Nicoli T.K., Bruce L.J., Tanner M.J., Ruiz-Linares A., Wrong O.M.
Pediatr. Nephrol. 21:212-217(2006)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close