Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP021784HUe1-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P55000
Gene Names
SLURP1
Organism
Homo sapiens (Human)
AA Sequence
LKCYTCKEPMTSASCRTITRCKPEDTACMTTLVTV EAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIF CCFRDLCNSEL
Expression Region
23-103aa
Sequence Info
Full Length of Mature Protein
Tag Info
NO-tagged
MW
8.9 kDa
Alternative Name(s)
ARS component B
ARS(component B)-81/S
Anti-neoplastic urinary protein
Relevance
Has an antitumor activity. Was found to be a marker of late differentiation of the skin. Implicated in maintaining the physiological and structural integrity of the keratinocyte layers of the skin. In vitro down-regulates keratinocyte proliferation; the function may involve the proposed role as modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-7-dependent nAChR currents in an allosteric manner. In T cells may be involved in regulation of intracellular Ca2+ signaling. Seems to have a immunomodulatory function in the cornea. The function may implicate a possible role as a scavenger receptor for PLAU thereby blocking PLAU-dependent functions of PLAUR such as in cell migration and proliferation
Reference
"Partial N-terminal amino acid sequence of the anti-neoplastic urinary protein (ANUP) and the anti-tumour effect of the N-terminal nonapeptide of the unique cytokine present in human granulocytes."
Ridge R.J., Sloane N.H.
Cytokine 8:1-5(1996)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €331.43
Price: €331.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close