Recombinant Human Extracellular superoxide dismutase [Cu-Zn](SOD3)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP022399HUa0-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Cell Biology
Target / Protein
SOD3
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P08294
AA Sequence
WTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRR DDDGALHAACQVQPSATLDAAQPRVTGVVLFRQLA PRAKLDAFFALEGFPTEPNSSSRAIHVHQFGDLSQ GCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWR YRAGLAASLAGPHSIVGRAVVVHAGEDDLGRGGNQ ASVENGNAGRRLACCVVGVCGPGLWERQAREHSER KKRRRESECKAA
Tag info
N-terminal 6xHis-tagged
Expression Region
19-240aa
Protein length
Full Length of Mature Protein
MW
28.1 kDa
Relevance
Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
Reference
"Extracellular superoxide dismutase (SOD3): tissue-specific expression, genomic characterization, and computer-assisted sequence analysis of the human EC SOD gene."
Folz R.J., Crapo J.D.
Genomics 22:162-171(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close