Comparison

Recombinant Human High mobility group protein B1(HMGB1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-RP016044h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
High mobility group protein 1 ; HMG-1
AA Sequence
KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFS KKCSERWKTMSAKEKGKFEDMAKADKARYEREMKT YIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPK IKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKK AAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P09429
Gene Names
HMGB1
Tag Info
N-terminal GST-tagged
Expression Region
8-179aa
MW of Fusion Proten
46, 7
Sequence Info
Partial
Relevance
DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .
Reference
A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.Wen L., Huang J.K., Johnson B.H., Reeck G.R.Nucleic Acids Res. 17:1197-1214(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close