Recombinant Human HLA class I histocompatibility antigen, alpha chain G(HLA-G),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 1mg
Host E.coli
Item no. CSB-RP021094h-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Immunology
Target / Protein
HLA-G
Biologically active
Not Test
Species of origin
Homo sapiens (Human)
Uniprot ID
P17693
AA Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVR FDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAH AQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAA QISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENG KEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYP AEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWA AVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLP TIPI
Tag info
N-terminal 6xHis-SUMO-tagged
Expression Region
25-308aa
Protein length
Extracellular Domain
MW
48.7 kDa
Alternative Name(s)
HLA G antigen
MHC class I antigen G
Relevance
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Reference
"A human major histocompatibility complex class I gene that encodes a protein with a shortened cytoplasmic segment."
Geraghty D.E., Koller B.H., Orr H.T.
Proc. Natl. Acad. Sci. U.S.A. 84:9145-9149(1987)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,246.43
Price: €1,246.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close