Recombinant Human 14-3-3 protein eta(YWHAH),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 200ug
Host E.coli
Item no. CSB-RP021744h-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
Q04917
Gene Names
YWHAH
Organism
Homo sapiens (Human)
AA Sequence
REQLLQRARLAEQAERYDDMASAMKAVTELNEPLS NEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMAD GNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFL IKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKK NSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALN FSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNE DSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
Expression Region
4-246aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
54.9 kDa
Alternative Name(s)
Protein AS1
Relevance
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Reference
A genome annotation-driven approach to cloning the human ORFeome.Collins J.E., Wright C.L., Edwards C.A., Davis M.P., Grinham J.A., Cole C.G., Goward M.E., Aguado B., Mallya M., Mokrab Y., Huckle E.J., Beare D.M., Dunham I.Genome Biol. 5:R84.1-R84.11(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close