Recombinant Macaca fascicularis Alpha-synuclein(SNCA)

Manufacturer Cusabio
Category
Type Proteins
Specific against Monkey
Amount 10ug
Host E.coli
ArtNr CSB-EP021912MOV-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P61142
Gene Names
SNCA
Organism
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
AA Sequence
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKE GVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEE GAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA
Expression Region
1-140aa
Sequence Info
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
30.5 kDa
Relevance
May be involved in the regulation of dopamine release and transport.
Reference
Alpha-synuclein A53T substitution associated with Parkinson disease also marks the divergence of Old World and New World primates.Hamilton B.A.Genomics 83:739-742(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €224.38
Price: €224.38
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close