Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 10ug
Host E.coli
ArtNr CSB-EP015849MOb1-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Epigenetics and Nuclear Signaling
Target / Protein
Nkx3-2
Biologically active
Not Test
Species of origin
Mus musculus (Mouse)
Uniprot ID
P97503
AA Sequence
MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPA PGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSL LASPARTRTAVGQSAESPGGWDSDSALSEENEGRR RCADVPGASGTGRARVTLGLDQPGCELHAAKDLEE EAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVP GLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSR AAFSHAQVFELERRFNHQRYLSGPERADLAASLKL TETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPY YCLPGWALSTCAAAAGTQ
Tag info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
1-333aa
Protein length
Full Length
MW
40.2 kDa
Alternative Name(s)
Bagpipe homeobox protein homolog 1
Homeobox protein NK-3 homolog B
Relevance
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Reference
"Bapx1: an evolutionary conserved homologue of the Drosophila bagpipe homeobox gene is expressed in splanchnic mesoderm and the embryonic skeleton."
Tribioli C., Frasch M., Lufkin T.
Mech. Dev. 65:145-162(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close