Recombinant Mouse Homeobox protein Nkx-3.2(Nkx3-2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 50ug
Host E.coli
ArtNr CSB-EP015849MOe1-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P97503
Gene Names
Nkx3-2
Organism
Mus musculus (Mouse)
AA Sequence
MAVRGSGTLTPFSIQAILNKKEERGGLATPEGRPA PGGTEVAVTAAPAVCCWRIFGETEAGALGGAEDSL LASPARTRTAVGQSAESPGGWDSDSALSEENEGRR RCADVPGASGTGRARVTLGLDQPGCELHAAKDLEE EAPVRSDSEMSASVSGDHSPRGEDDSVSPGGARVP GLRGAAGSGASGGQAGGVEEEEEPAAPKPRKKRSR AAFSHAQVFELERRFNHQRYLSGPERADLAASLKL TETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKV AVKVLVRDDQRQYLPGEVLRPPSLLPLQPSYYYPY YCLPGWALSTCAAAAGTQ
Expression Region
1-333aa
Sequence Info
Full Length
Tag Info
NO-tagged
MW
35.2 kDa
Alternative Name(s)
Bagpipe homeobox protein homolog 1
Homeobox protein NK-3 homolog B
Relevance
Transcriptional repressor that acts as a negative regulator of chondrocyte maturation. PLays a role in distal stomach development; required for proper antral-pyloric morphogenesis and development of antral-type epithelium. In concert with GSC, defines the structural components of the middle ear; required for tympanic ring and gonium development and in the regulation of the width of the malleus.
Reference
"Bapx1 regulates patterning in the middle ear: altered regulatory role in the transition from the proximal jaw during vertebrate evolution."
Tucker A.S., Watson R.P., Lettice L.A., Yamada G., Hill R.E.
Development 131:1235-1245(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €361.43
Price: €361.43
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close