Recombinant Mouse Neural retina-specific leucine zipper protein(Nrl)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 50ug
Host E.coli
ArtNr CSB-EP016086MO-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P54846
Gene Names
Nrl
Organism
Mus musculus (Mouse)
AA Sequence
MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVP TASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLE ELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPV SMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSM SVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQA CRSKRLQQRRGLEAERARLAAQLDALRAEVARLAR ERDLYKARCDRLTSGGPGSDDHTHLFL
Expression Region
1-237aa
Sequence Info
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW
46.1 kDa
Relevance
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
Reference
"Sumoylation of bZIP transcription factor NRL modulates target gene expression during photoreceptor differentiation."
Roger J.E., Nellissery J., Kim D.S., Swaroop A.
J. Biol. Chem. 285:25637-25644(2010)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €342.86
Price: €342.86
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close