Recombinant Mouse [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4,mitochondrial(Pdk4),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 10ug
Host E.coli
ArtNr CSB-EP017730MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Metabolism
Target / Protein
Pdk4
Biologically active
Not Test
Species of origin
Mus musculus (Mouse)
Uniprot ID
O70571
AA Sequence
ILEYKDTCTVDPVTNQNLQYFLDRFYMNRISTRML MNQHILIFSDSKTGNPSHIGSIDPNCDVVAVVQDA FECAKMLCDQYYLTSPELNLTQVNGKFPGQPIHIV YVPSHLHHMLFELFKNAMRATVEHQENRPSLTPVE ATVVLGKEDLTIKISDRGGGVPLRITDRLFSYTYS TAPTPVMDNSRNAPLAGFGYGLPISRLYAKYFQGD LNLYSMSGYGTDAIIYLKALS
Tag info
N-terminal 6xHis-tagged
Expression Region
138-368aa
Protein length
Partial
MW
30.0 kDa
Alternative Name(s)
Pyruvate dehydrogenase kinase isoform 4
Relevance
Kinase that plays a key role in regulation of glucose and fatty acid metabolism and homeostasis via phosphorylation of the pyruvate dehydrogenase subunits PDHA1 and PDHA2. This inhibits pyruvate dehydrogenase activity, and thereby regulates metabolite flux through the tricarboxylic acid cycle, down-regulates aerobic respiration and inhibits the formation of acetyl-coenzyme A from pyruvate. Inhibition of pyruvate dehydrogenase decreases glucose utilization and increases fat metabolism in response to prolonged fasting and starvation. Plays an important role in maintaining normal blood glucose levels under starvation, and is involved in the insulin signaling cascade. Via its regulation of pyruvate dehydrogenase activity, plays an important role in maintaining normal blood pH and in preventing the accumulation of ketone bodies under starvation. In the fed state, mediates cellular responses to glucose levels and to a high-fat diet. Regulates both fatty acid oxidation and de novo fatty acid biosynthesis. Plays a role in the generation of reactive oxygen species. Protects detached epithelial cells against anoikis. Plays a role in cell proliferation via its role in regulating carbohydrate and fatty acid metabolism
Reference
"Promoter and partial structural region of Mus musculus pyruvate dehydrogenase kinase 4 (PDK4)."
Jeoung N.H., Bowker-Kinley M.M., Harris R.A.
Submitted (FEB-2000)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close