Comparison

Recombinant Mouse Pituitary homeobox 3(Pitx3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP018044MO-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
O35160
Gene Names
Pitx3
Organism
Mus musculus (Mouse)
AA Sequence
MEFGLLGEAEARSPALSLSDAGTPHPPLPEHGCKG QEHSDSEKASASLPGGSPEDGSLKKKQRRQRTHFT SQQLQELEATFQRNRYPDMSTREEIAVWTNLTEAR VRVWFKNRRAKWRKRERSQQAELCKGGFAAPLGGL VPPYEEVYPGYSYGNWPPKALAPPLAAKTFPFAFN SVNVGPLASQPVFSPPSSIAASMVPSAAAAPGTVP GPGALQGLGGAPPGLAPAAVSSGAVSCPYASAAAA AAAAASSPYVYRDPCNSSLASLRLKAKQHASFSYP AVPGPPPAANLSPCQYAVERPV
Expression Region
1-302aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
58.7 kDa
Alternative Name
Homeobox protein PITX3. Paired-like homeodomain transcription factor 3
Relevance
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. In addition to its importance during development, it also has roles in the long-term survival and maintenance of the mdDA neurons. Activates NR4A2/NURR1-mediated transcription of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons. Acts by decreasing the interaction of NR4A2/NURR1 with the corepressor NCOR2/SMRT which acts through histone deacetylases (HDACs) to keep promoters of NR4A2/NURR1 target genes in a repressed deacetylated state. Essential for the normal lens development and differentiation. Plays a critical role in the maintenance of mitotic activity of lens epithelial cells, fiber cell differentiation and in the control of the tporal and spatial activation of fiber cell-specific crystallins. Positively regulates FOXE3 expression and negatively regulates PROX1 in the anterior lens epithelium, preventing activation of CDKN1B/P27Kip1 and CDKN1C/P57Kip2 and thus maintains lens epithelial cells in cell cycle.
Reference
Induction of tyrosine hydroxylase expression by the transcription factor Pitx3.Messmer K., Remington M.P., Skidmore F., Fishman P.S.Int. J. Dev. Neurosci. 25:29-37(2007)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcriptional regulator which is important for the differentiation and maintenance of meso-diencephalic dopaminergic (mdDA) neurons during development. In addition to its importance during development, it also has roles in the long-term survival and maintenance of the mdDA neurons. Activates NR4A2/NURR1-mediated transcription of genes such as SLC6A3, SLC18A2, TH and DRD2 which are essential for development of mdDA neurons. Acts by decreasing the interaction of NR4A2/NURR1 with the corepressor NCOR2/SMRT which acts through histone deacetylases (HDACs) to keep promoters of NR4A2/NURR1 target genes in a repressed deacetylated state. Essential for the normal lens development and differentiation. Plays a critical role in the maintenance of mitotic activity of lens epithelial cells, fiber cell differentiation and in the control of the temporal and spatial activation of fiber cell-specific crystallins. Positively regulates FOXE3 expression and negatively regulates PROX1 in the anterior lens epithelium, preventing activation of CDKN1B/P27Kip1 and CDKN1C/P57Kip2 and thus maintains lens epithelial cells in cell cycle.
Involvement in disease
Mutations in Pitx3 appear to be the cause of the aphakia (ak) phenotype, a recessive homozygous disease characterized by small eyes and closed eyelids.
Subcellular Location
Nucleus
Protein Families
Paired homeobox family, Bicoid subfamily
Tissue Specificity
Highly expressed in developing eye lens. Expression is restricted to the substantia nigra and ventral tegmental area in the midbrain.
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close