Recombinant Mouse Pyruvate kinase PKM(Pkm)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 100ug
Host E.coli
ArtNr CSB-EP018072MO-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P52480
Gene Names
Pkm
Organism
Mus musculus (Mouse)
AA Sequence
MPKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDI DSAPITARNTGIICTIGPASRSVEMLKEMIKSGMN VARLNFSHGTHEYHAETIKNVREATESFASDPILY RPVAVALDTKGPEIRTGLIKGSGTAEVELKKGATL KITLDNAYMEKCDENILWLDYKNICKVVEVGSKIY VDDGLISLQVKEKGADFLVTEVENGGSLGSKKGVN LPGAAVDLPAVSEKDIQDLKFGVEQDVDMVFASFI RKAADVHEVRKVLGEKGKNIKIISKIENHEGVRRF DEILEASDGIMVARGDLGIEIPAEKVFLAQKMMIG RCNRAGKPVICATQMLESMIKKPRPTRAEGSDVAN AVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREA EAAIYHLQLFEELRRLAPITSDPTEAAAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTR NPQTARQAHLYRGIFPVLCKDAVLNAWAEDVDLRV NLAMDVGKARGFFKKGDVVIVLTGWRPGSGFTNTM RVVPVP
Expression Region
1-531aa
Sequence Info
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
62.8 kDa
Alternative Name(s)
Pyruvate kinase muscle isozyme
Pk3, Pkm2, Pykm
Relevance
Glycolytic enzyme that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP. Stimulates POU5F1-mediated transcriptional activation
Reference
"Gene expression of mouse M1 and M2 pyruvate kinase isoenzymes correlates with differential poly(A) tract extension of their mRNAs during the development of spermatogenesis."
de Luis O., del Mazo J.
Biochim. Biophys. Acta 1396:294-305(1998)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 100ug
Available: In stock
Listprice: €555.00
Price: €555.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close