Recombinant Mouse Peroxisome proliferator-activated receptor gamma(Pparg)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 10ug
Host E.coli
ArtNr CSB-EP018424MOb0-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Epigenetics and Nuclear Signaling
Target / Protein
Pparg
Biologically active
Not Test
Species of origin
Mus musculus (Mouse)
Uniprot ID
P37238
AA Sequence
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTE MPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDF SSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSA IKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECR VCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDR CDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKH LYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDM NSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQF RSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLR KPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPE SSQLFAKVLQKMTDLRQIVTEHVQLLHVIKKTETD MSLHPLLQEIYKDLY
Tag info
N-terminal 10xHis-tagged
Expression Region
1-505aa
Protein length
Full Length
MW
63.3 kDa
Relevance
Nuclear receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Once activated by a ligand, the nuclear receptor binds to DNA specific PPAR response elements (PPRE) and modulates the transcription of its target genes, such as acyl-CoA oxidase. It therefore controls the peroxisomal beta-oxidation pathway of fatty acids. Key regulator of adipocyte differentiation and glucose homeostasis. ARF6 acts as a key regulator of the tissue-specific adipocyte P2 (aP2) enhancer. Acts as a critical regulator of gut homeostasis by suppressing NF-kappa-B-mediated proinflammatory responses. Plays a role in the regulation of cardiovascular circadian rhythms by regulating the transcription of ARNTL/BMAL1 in the blood vessels
Reference
"mPPAR gamma 2: tissue-specific regulator of an adipocyte enhancer."
Tontonoz P., Hu E., Graves R.A., Budavari A.I., Spiegelman B.M.
Genes Dev. 8:1224-1234(1994)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close