Comparison

Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 10ug
Host E.coli
Item no. CSB-EP019153MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
Q9CYK2
Gene Names
Qpct
Organism
Mus musculus (Mouse)
AA Sequence
AWTQEKNHHQPAHLNSSSLQQVAEGTSISEMWQND LRPLLIERYPGSPGSYSARQHIMQRIQRLQAEWVV EVDTFLSRTPYGYRSFSNIISTLNPEAKRHLVLAC HYDSKYFPRWDSRVFVGATDSAVPCAMMLELARAL DKKLHSLKDVSGSKPDLSLRLIFFDGEEAFHHWSP QDSLYGSRHLAQKMASSPHPPGSRGTNQLDGMDLL VLLDLIGAANPTFPNFFPKTTRWFNRLQAIEKELY ELGLLKDHSLERKYFQNFGYGNIIQDDHIPFLRKG VPVLHLIASPFPEVWHTMDDNEENLHASTIDNLNK IIQVFVLEYLHL
Expression Region
36-362aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
41.6 kDa
Alternative Name(s)
Glutaminyl cyclase
Short name:QC; Glutaminyl-tRNA cyclotransferase
Relevance
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue (By similarity).
Reference
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close