Recombinant Mouse Resistin(Retn)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 50ug
Host E.coli
ArtNr CSB-EP019573MO-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
Q99P87
Gene Names
Retn
Organism
Mus musculus (Mouse)
AA Sequence
SSMPLCPIDEAIDKKIKQDFNSLFPNAIKNIGLNC WTVSSRGKLASCPEGTAVLSCSCGSACGSWDIREE KVCHCQCARIDWTAARCCKLQVAS
Expression Region
21-114aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
MW
14.2 kDa
Alternative Name(s)
Adipose tissue-specific secretory factor ; ADSFAdipose-specific cysteine-rich secreted protein A12-alpha; Cysteine-rich secreted protein FIZZ3
Relevance
Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes.
Reference
Disulfide-dependent multimeric assembly of resistin family hormones.Patel S.D., Rajala M.W., Rossetti L., Scherer P.E., Shapiro L.Science 304:1154-1158(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close