Recombinant Mouse Secreted frizzled-related protein 5(Sfrp5)

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 50ug
Host E.coli
ArtNr CSB-EP021141MO-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Stem Cells
Target / Protein
Sfrp5
Biologically active
Not Test
Species of origin
Mus musculus (Mouse)
Uniprot ID
Q9WU66
AA Sequence
APTRGQEYDYYGWQAEPLHGRSYSKPPQCLDIPAD LPLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLP LLAKRCHSDTQVFLCSLFAPVCLDRPIYPCRSLCE AARAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIA VQFGHLPATAPPVTKICAQCEMEHSADGLMEQMCS SDFVVKMRIKEIKIDNGDRKLIGAQKKKKLLKAGP LKRKDTKKLVLHMKNGASCPCPQLDNLTGSFLVMG RKVEGQLLLTAVYRWDKKNKEMKFAVKFMFSYPCS LYYPFFYGAAEPH
Tag info
N-terminal 6xHis-tagged
Expression Region
22-314aa
Protein length
Full Length of Mature Protein
MW
37.2 kDa
Relevance
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP5 may be involved in determining the polarity of photoreceptor, and perhaps, other cells in the retina.
Reference
"Absence of Nodal signaling promotes precocious neural differentiation in the mouse embryo."
Camus A., Perea-Gomez A., Moreau A., Collignon J.
Dev. Biol. 295:743-755(2006)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €282.14
Price: €282.14
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close