Recombinant Mouse SLAM family member 7(Slamf7),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Mouse
Amount 50ug
Host E.coli
ArtNr CSB-EP021369MO1-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
Immunology
Target / Protein
Slamf7
Biologically active
Not Test
Species of origin
Mus musculus (Mouse)
Uniprot ID
Q8BHK6
AA Sequence
SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNT FFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQL KKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSR PKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWK AVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNP VSNSFSTPVFPQKLCEDAATDLTSLRG
Tag info
N-terminal 6xHis-tagged
Expression Region
23-224aa
Protein length
Partial
MW
27.8 kDa
Alternative Name(s)
Leukocyte cell-surface antigen
Novel Ly9
CD_antigen: CD319
Relevance
Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines
Reference
"Mouse novel Ly9: a new member of the expanding CD150 (SLAM) family of leukocyte cell-surface receptors."
Tovar V., Del Valle J., Zapater N., Martin M., Romero X., Pizcueta P., Bosch J., Terhorst C., Engel P.
Immunogenetics 54:394-402(2002)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €181.25
Price: €181.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close