Comparison

Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase(GAPDH)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009232HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
GAPDH
Alternative name(s):
Peptidyl-cysteine S-nitrosylase GAPDH
AA Sequence
GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDP FIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVING NPITIFQERDPSKIKWGDAGAEYVVESTGVFTTME KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYD NSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMT TVHAITATQKTVDGPSGKLWRDGRGALQNIIPAST GAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLT CRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQV VSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDN EFGYSNRVVDLMAHMASKE
Research Topic
Neuroscience
Uniprot ID
P04406
Gene Names
GAPDH
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-335aa
MW of Fusion Proten
51, 9
Sequence Info
Full Length
Relevance
Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D-glyceroyl phosphate. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation.
Reference
"Haponin (eIF1AD) interacts with glyceraldehyde 3-phosphate dehydrogenase in the CHO-K1 cell line."Rakitina T.V., Bogatova O.V., Smirnova E.V., Pozdeev V.I., Kostanian I.A., Lipkin V.M.Bioorg. Khim. 36:312-318(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close