Recombinant Human Grancalcin(GCA)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP009307HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P28676
Gene Names
GCA
Organism
Homo sapiens (Human)
AA Sequence
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILL DGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDH TGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFF DDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF LQGTMAI
Expression Region
1-217aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
51 kDa
Relevance
Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions.
Reference
"Biochemical characterization of the penta-EF-hand protein grancalcin and identification of L-plastin as a binding partner."
Lollike K., Johnsen A.H., Durussel I., Borregaard N., Cox J.A.
J. Biol. Chem. 276:17762-17769(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close