Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP009307HU-10 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P28676 |
Gene Names |
GCA |
Organism |
Homo sapiens (Human) |
AA Sequence |
MAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAILL DGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDA EELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDH TGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVE HHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFF DDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDF LQGTMAI |
Expression Region |
1-217aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
51 kDa |
Relevance |
Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions. |
Reference |
"Biochemical characterization of the penta-EF-hand protein grancalcin and identification of L-plastin as a binding partner." Lollike K., Johnsen A.H., Durussel I., Borregaard N., Cox J.A. J. Biol. Chem. 276:17762-17769(2001) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Calcium-binding protein that may play a role in the adhesion of neutrophils to fibronectin. May play a role in the formation of focal adhesions. |
Subcellular Location |
Cytoplasm, Cytoplasmic granule membrane, Peripheral membrane protein, Cytoplasmic side |
Tissue Specificity |
Detected in neutrophils and macrophages (at protein level). Highly expressed in bone marrow. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.