Recombinant Human Growth/differentiation factor 11(GDF11)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP009344HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
O95390
Gene Names
GDF11
Organism
Homo sapiens (Human)
AA Sequence
NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAP KRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSA GPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDR CGCS
Expression Region
299-407aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
28.5 kDa
Alternative Name(s)
Bone morphogenetic protein 11
Short name:
BMP-11
Relevance
Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern.
Reference
"A novel BMP expressed in developing mouse limb, spinal cord, and tail bud is a potent mesoderm inducer in Xenopus embryos."Gamer L.W., Wolfman N.M., Celeste A.J., Hattersley G., Hewick R., Rosen V.Dev. Biol. 208:222-232(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close