Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP009500HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P10070 |
Gene Names |
GLI2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTK EYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQ KPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSR LENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRA KHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVK TVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTE PGGPESTEASSTSQAVEDCL |
Expression Region |
412-641aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
42.5 kDa |
Alternative Name(s) |
GLI family zinc finger protein 2 Tax helper protein |
Relevance |
Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856). |
Reference |
"Novel heterozygous nonsense GLI2 mutations in patients with hypopituitarism and ectopic posterior pituitary lobe without holoprosencephaly."Franca M.M., Jorge A.A., Carvalho L.R., Costalonga E.F., Vasques G.A., Leite C.C., Mendonca B.B., Arnhold I.J.J. Clin. Endocrinol. Metab. 95:E384-E391(2010) . |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Functions as transcription regulator in the hedgehog (Hh) pathway |
Involvement in disease |
Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS) |
Subcellular Location |
Nucleus, Cytoplasm, Cell projection, cilium |
Protein Families |
GLI C2H2-type zinc-finger protein family |
Tissue Specificity |
Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (PubMed:9557682). Isoform 3 and isoform 4 are weakly expressed in HTLV-1-infected T-cell lines (PubMed:9557682). |
Paythway |
Hedgehogsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.