Recombinant Human Glutaminase kidney isoform, mitochondrial(GLS),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP009528HU(F)-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
O94925
Gene Names
GLS
Organism
Homo sapiens (Human)
AA Sequence
YVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEG TDMVGILDFYFQLCSIEVTCESASVMAATLANGGF CPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAF HVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMG NSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR EGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDM EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPF PKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQ GDSDNGKENQTVHKNLDGLL
Expression Region
370-669aa
Sequence Info
Partial
Tag Info
N-terminal GST-tagged
MW
60.4 kDa
Alternative Name(s)
K-glutaminase
L-glutamine amidohydrolase
Relevance
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.
Reference
"Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close