Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP009528HU(F)-10 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Metabolism |
Uniprot ID |
O94925 |
Gene Names |
GLS |
Organism |
Homo sapiens (Human) |
AA Sequence |
YVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEG TDMVGILDFYFQLCSIEVTCESASVMAATLANGGF CPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAF HVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMG NSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRR EGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDM EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPF PKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQ GDSDNGKENQTVHKNLDGLL |
Expression Region |
370-669aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
60.4 kDa |
Alternative Name(s) |
K-glutaminase L-glutamine amidohydrolase |
Relevance |
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. |
Reference |
"Cloning and analysis of unique human glutaminase isoforms generated by tissue-specific alternative splicing."Elgadi K.M., Meguid R.A., Qian M., Souba W.W., Abcouwer S.F.Physiol. Genomics 1:51-62(1999) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. |
Subcellular Location |
Isoform 1: Cytoplasm, cytosol, SUBCELLULAR LOCATION: Isoform 3: Mitochondrion |
Protein Families |
Glutaminase family |
Tissue Specificity |
Isoform 1 and isoform 3 are detected in brain cortex. Isoform 3 is highly expressed in astrocytoma, ganglioglioma and ependymoma. Isoform 1 is highly expressed in brain and kidney, but not detected in liver. Isoform 3 is highly expressed in heart and pancreas, detected at lower levels in placenta, lung, pancreas and kidney, but is not detected in liver. Isoform 2 is expressed in cardiac and skeletal muscle. |
Paythway |
Glutamatergicsynapse |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.