Comparison

Recombinant Mouse Golgi membrane protein 1(Golm1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009666MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Golgi membrane protein GP73
Golgi phosphoprotein 2
AA Sequence
SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEF QGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAV LVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQ FQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIE EVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEE VPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQV QNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEK LDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQ QRASEEGGGQKNPGDEYDMDENEAESEREKQAALA GNDRNINVLNADAQKRGIINVPVGSERQSHILNQV GIHIPQQA
Research Topic
Signal Transduction
Uniprot ID
Q91XA2
Gene Names
Golm1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
36-393aa
MW of Fusion Proten
56, 6
Sequence Info
Full Length of Mature Protein
Relevance
Unknown. Cellular response protein to viral infection (By similarity).
Reference
"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close