« Back
Home /
Recombinant Mouse Golgi membrane protein 1(Golm1),partial

Recombinant Mouse Golgi membrane protein 1(Golm1),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP009666MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	Q91XA2
Gene Names	Golm1
Organism	Mus musculus (Mouse)
AA Sequence	SSRSVELQTRIVELEGRVRRAAAERGAVELKKNEF QGELQKQREQLDRIQSSHSFQLENVNKLHQDEKAV LVNNITTGEKLIRDLQDQLKALQRSYSSLQQDIFQ FQKNQTSLEKKFSYDLNQCISQMTEVKEQCDERIE EVIRKRNEAPGSRDLAETNNQHQQALKPQPKLQEE VPSEEQMPQEKGDVPRNKSQIPAPNSESLGLKPQV QNEETNEIQAVGEEHQQASIQGQAVADGTRVGAEK LDQHTQLPAGLLARPEEDSQYPEREQLVIRDRQEQ QRASEEGGGQKNPGDEYDMDENEAESEREKQAALA GNDRNINVLNADAQKRGIINVPVGSERQSHILNQV GIHIPQQA
Expression Region	36-393aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	56.6 kDa
Alternative Name(s)	Golgi membrane protein GP73 Golgi phosphoprotein 2
Relevance	Unknown. Cellular response protein to viral infection (By similarity).
Reference	"A tissue-specific atlas of mouse protein phosphorylation and expression."Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R., Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.Cell 143:1174-1189(2010)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Unknown. Cellular response protein to viral infection (By similarity).
Subcellular Location	Golgi apparatus, cis-Golgi network membrane, Single-pass type II membrane protein
Protein Families	GOLM1/CASC4 family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time