Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP009870HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
O75715 |
Gene Names |
GPX5 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKD EKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVA TYCGLTAQYPGMSVQGEDLYLVSSFLRKGM |
Expression Region |
1-100aa |
Sequence Info |
Full Length of Isoform 2 |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-Trx-tagged |
MW |
28.4 kDa |
Alternative Name(s) |
Epididymis-specific glutathione peroxidase-like protein |
Relevance |
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. |
Reference |
"The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract." Hall L., Williams K., Perry A.C.F., Frayne J., Jury J.A. Biochem. J. 333:5-9(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. |
Subcellular Location |
Secreted |
Protein Families |
Glutathione peroxidase family |
Tissue Specificity |
Epididymis. |
Paythway |
Th17celldifferentiation |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.