Recombinant Human Epididymal secretory glutathione peroxidase(GPX5)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP009870HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O75715
Gene Names
GPX5
Organism
Homo sapiens (Human)
AA Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKD EKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVA TYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Expression Region
1-100aa
Sequence Info
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-Trx-tagged
MW
28.4 kDa
Alternative Name(s)
Epididymis-specific glutathione peroxidase-like protein
Relevance
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Reference
"The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract."
Hall L., Williams K., Perry A.C.F., Frayne J., Jury J.A.
Biochem. J. 333:5-9(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €186.25
Price: €186.25
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close