Comparison

Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009870PI-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Epididymis-specific glutathione peroxidase-like protein
Short name:EGLP
AA Sequence
NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQ YAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFG LVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGY VPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELI GSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRW VHETPISTVKSDILAYLKQFKTE
Research Topic
Signal Transduction
Uniprot ID
O18994
Gene Names
GPX5
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
22-219aa
MW of Fusion Proten
27, 6
Sequence Info
Full Length of Mature Protein
Relevance
May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction.
Reference
"Molecular cloning and characterization of the epididymis-specific glutathione peroxidase-like protein secreted in the porcine epididymal fluid."Okamura N., Iwaki Y., Hiramoto S., Tamba M., Bannai S., Sugita Y., Syntin P., Dacheux F., Dacheux J.-L.Biochim. Biophys. Acta 1336:99-109(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Sus scrofa (Pig)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close