« Back
Home /
Recombinant Rat Gremlin-1(Grem1)

Recombinant Rat Gremlin-1(Grem1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP009892RA-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	O35793
Gene Names	Grem1
Organism	Rattus norvegicus (Rat)
AA Sequence	KKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRG RGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWC KTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPR HIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPP TKKKRVTRVKQCRCISIDLD
Expression Region	25-184aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	34.2 kDa
Alternative Name(s)	Cysteine knot superfamily 1, BMP antagonist 1 Down-regulated in Mos-transformed cells protein
Relevance	Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner (By similarity). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed.
Reference	"Identification of drm, a novel gene whose expression is suppressed in transformed cells and which can inhibit growth of normal but not transformed cells in culture."Topol L.Z., Marx M., Laugier D., Bogdanova N.N., Boubnov N.V., Clausen P.A., Calothy G., Blair D.G.Mol. Cell. Biol. 17:4801-4810(1997)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner (By similarity). Antagonist of BMP2; inhibits BMP2-mediated differentiation of osteoblasts (in vitro) (By similarity). Acts as inhibitor of monocyte chemotaxis
Subcellular Location	Secreted
Protein Families	DAN family
Tissue Specificity	Highly expressed in the brain, kidney, spleen, and testis and weakly expressed in the lung and liver. Predominantly expressed in differentiated cells as neurons in brain, type I cells in lung and globlet cells in intestine.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time