Comparison

Recombinant Rat Gremlin-1(Grem1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009892RA-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Cysteine knot superfamily 1, BMP antagonist 1
Down-regulated in Mos-transformed cells protein
AA Sequence
KKKGSQGAIPPPDKAQHNDSEQTQSPPQPGSRTRG RGQGRGTAMPGEEVLESSQEALHVTERKYLKRDWC KTQPLKQTIHEEGCNSRTIINRFCYGQCNSFYIPR HIRKEEGSFQSCSFCKPKKFTTMMVTLNCPELQPP TKKKRVTRVKQCRCISIDLD
Research Topic
Signal Transduction
Uniprot ID
O35793
Gene Names
Grem1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
25-184aa
MW of Fusion Proten
34, 2
Sequence Info
Full Length
Relevance
Cytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner (By similarity). Acts as inhibitor of monocyte chemotaxis. Can inhibit the growth or viability of normal cells but not transformed cells when is overexpressed.
Reference
"Identification of drm, a novel gene whose expression is suppressed in transformed cells and which can inhibit growth of normal but not transformed cells in culture."Topol L.Z., Marx M., Laugier D., Bogdanova N.N., Boubnov N.V., Clausen P.A., Calothy G., Blair D.G.Mol. Cell. Biol. 17:4801-4810(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close