Comparison

Recombinant Human Glutathione S-transferase A2(GSTA2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP009971HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
GST HA subunit 2
GST class-alpha member 2
GST-gamma
GSTA2-2
GTH2
AA Sequence
MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFI KSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA ILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEM ILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVL KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLI SSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE KSLEESRKIFRF
Research Topic
Signal Transduction
Uniprot ID
P09210
Gene Names
GSTA2
Tag Info
N-terminal GST-tagged
Expression Region
1-222aa
MW of Fusion Proten
52, 7
Sequence Info
Full Length of BC002895
Relevance
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Reference
"The basic glutathione S-transferases from human livers are products of separate genes."
Rhoads D.M., Zarlengo R.P., Tu C.-P.D.
Biochem. Biophys. Res. Commun. 145:474-481(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close