« Back
Home /
Recombinant Human Glutathione S-transferase A2(GSTA2)

Recombinant Human Glutathione S-transferase A2(GSTA2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP009971HU-10
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P09210
Gene Names	GSTA2
Organism	Homo sapiens (Human)
AA Sequence	MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFI KSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRA ILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEM ILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVL KSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLI SSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDE KSLEESRKIFRF
Expression Region	1-222aa
Sequence Info	Full Length of BC002895
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	52.7 kDa
Alternative Name(s)	GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2
Relevance	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Reference	"The basic glutathione S-transferases from human livers are products of separate genes." Rhoads D.M., Zarlengo R.P., Tu C.-P.D. Biochem. Biophys. Res. Commun. 145:474-481(1987)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Subcellular Location	Cytoplasm
Protein Families	GST superfamily, Alpha family
Tissue Specificity	Liver.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time