Recombinant Human Maleylacetoacetate isomerase(GSTZ1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP009994HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O43708
Gene Names
GSTZ1
Organism
Homo sapiens (Human)
AA Sequence
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVP INLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIH QSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDL IAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFN ALEQILQSTAGIYCVGDEVTMADLCLVPQVANAER FKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDT PTELRA
Expression Region
1-216aa
Sequence Info
Full Length of BC001453
Tag Info
N-terminal GST-tagged
MW
51.1 kDa
Alternative Name(s)
GSTZ1-1
Glutathione S-transferase zeta 1 (EC:2.5.1.18)
Relevance
Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1, 3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.
Reference
"Characterization of a fungal maleylacetoacetate isomerase gene and identification of its human homologue."
Fernandez-Canon J.M., Penalva M.A.
J. Biol. Chem. 273:329-337(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close