Recombinant Human Histone H2A.Z(H2AFZ)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP010100HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P0C0S5
Gene Names
H2AFZ
Organism
Homo sapiens (Human)
AA Sequence
AGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRH LKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAG NASKDLKVKRITPRHLQLAIRGDEELDSLIKATIA GGGVIPHIHKSLIGKKGQQKTV
Expression Region
1-128aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
40.4 kDa
Relevance
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in the formation of constitutive heterochromatin. May be required for chromosome segregation during cell division.
Reference
"Sequence of cDNAs for mammalian H2A.Z, an evolutionarily diverged but highly conserved basal histone H2A isoprotein species."
Hatch C.L., Bonner W.M.
Nucleic Acids Res. 16:1113-1124(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close