Comparison

Recombinant Human Hepatitis B virus X-interacting protein(HBXIP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010161HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Hepatitis B virus X-interacting protein
AA Sequence
MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRG TLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD NGNIMIQKHDGITVAVHKMAS
Research Topic
Cell Biology
Uniprot ID
O43504
Gene Names
HBXIP
Tag Info
N-terminal GST-tagged
Expression Region
1-91aa
MW of Fusion Proten
36, 6
Sequence Info
Full Length
Relevance
As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.
Reference
"Cloning and characterization of a novel hepatitis B virus x binding protein that inhibits viral replication."
Melegari M., Scaglioni P.P., Wands J.R.
J. Virol. 72:1737-1743(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close