Recombinant Human Hemoglobin subunit zeta(HBZ)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP010162HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P02008
Gene Names
HBZ
Organism
Homo sapiens (Human)
AA Sequence
SLTKTERTIIVSMWAKISTQADTIGTETLERLFLS HPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAV KSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCL LVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKY
Expression Region
1-142aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
42.5 kDa
Alternative Name(s)
HBAZ
Hemoglobin zeta chain
Zeta-globin
Relevance
The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin.
Reference
"The structure of the human zeta-globin gene and a closely linked, nearly identical pseudogene."
Proudfoot N.J., Gil A., Maniatis T.
Cell 31:553-563(1982)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close