Comparison

Recombinant Human Orexin receptor type 1(HCRTR1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Item no. CSB-EP010231HU1-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
O43613
Gene Names
HCRTR1
Organism
Homo sapiens (Human)
AA Sequence
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYL WRDYLYPKQYE
Expression Region
1-46aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
10.4 kDa
Alternative Name
Hypocretin receptor type 1
Relevance
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding
Reference
"Structure and ligand-binding mechanism of the human OX1 and OX2 orexin receptors."
Yin J., Babaoglu K., Brautigam C.A., Clark L., Shao Z., Scheuermann T.H., Harrell C.M., Gotter A.L., Roecker A.J., Winrow C.J., Renger J.J., Coleman P.J., Rosenbaum D.M.
Nat. Struct. Mol. Biol. 23:293-299(2016)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close