Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
500ug |
Item no. |
CSB-EP010231HU1-500 |
Conjugate/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Metabolism |
Uniprot ID |
O43613 |
Gene Names |
HCRTR1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYL WRDYLYPKQYE |
Expression Region |
1-46aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
MW |
10.4 kDa |
Alternative Name(s) |
Hypocretin receptor type 1 |
Relevance |
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide. Triggers an increase in cytoplasmic Ca2+ levels in response to orexin-A binding |
Reference |
"Structure and ligand-binding mechanism of the human OX1 and OX2 orexin receptors." Yin J., Babaoglu K., Brautigam C.A., Clark L., Shao Z., Scheuermann T.H., Harrell C.M., Gotter A.L., Roecker A.J., Winrow C.J., Renger J.J., Coleman P.J., Rosenbaum D.M. Nat. Struct. Mol. Biol. 23:293-299(2016) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide |
Subcellular Location |
Cell membrane, Multi-pass membrane protein |
Protein Families |
G-protein coupled receptor 1 family |
Tag Information |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.