Recombinant Human Histone deacetylase 11(HDAC11)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP010237HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q96DB2
Gene Names
HDAC11
Organism
Homo sapiens (Human)
AA Sequence
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLH PFDAGKWGKVINFLKEEKLLSDSMLVEAREASEED LLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFL VQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGG FHHCSSDRGGGFCAYADITLAIKFLFERVEGISRA TIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYP GDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKS LQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVK RDELVFRMVRGRRVPILMVTSGGYQKRTARIIADS ILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
Expression Region
1-347aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
66.2 kDa
Relevance
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.
Reference
"Chromosomal organization and localization of the novel class IV human histone deacetylase 11 gene."
Voelter-Mahlknecht S., Ho A.D., Mahlknecht U.
Int. J. Mol. Med. 16:589-598(2005)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close